top of page

Discounts available.

 

5 Products = 5% off order.

10 Products = 10% off order.

20 Products = 20% off order.

50 Products = 50% off order.

 

LL-37 is a synthetic antimicrobial peptide derived from the human cathelicidin protein (hCAP18). Known for its broad-spectrum antimicrobial and immunomodulatory properties, LL-37 plays a key role in research related to immune response, inflammation, and wound healing.

 

Key Features:
High Purity & Potency: Laboratory-grade LL-37, suitable for research purposes.
Antimicrobial Properties: Effective against a wide range of bacteria, viruses, and fungi in experimental models.
Immunomodulatory Potential: Studied for its role in reducing inflammation and promoting tissue repair.

 

Specifications:

Sequence: [LL-37, 37 aa]

Form: Lyophilized powder

Purity: ≥98%

Storage: Store in a cool, dry place. Reconstitute with bacteriostatic water or sterile solution before use.

 

Applications:

Microbial Resistance Research: Investigation of LL-37’s effectiveness against pathogens.

Wound Healing Studies: Evaluation of its tissue-repairing properties.

Inflammation Modulation: Exploration of its anti-inflammatory effects in vitro and in vivo.

 

Important:
LL-37 is strictly intended for research use only. Not for human consumption or therapeutic use. Handle with appropriate safety measures.

LL-37

£50.00Price

** Discount Available ** See description.

Quantity
  • At RPPeptides, customer satisfaction is our top priority. Due to the nature of our products being perishable goods, we do not offer refunds. However, if your item arrives damaged, broken, or faulty, we will send you a replacement free of charge.

     

    1. No Refunds

    As our products are perishable, we cannot accept returns or offer refunds on any purchases.

    2. Replacement Policy for Damaged, Broken, or Faulty Products

    If your product arrives damaged or faulty, we will provide a replacement at no additional cost. To qualify for a replacement:

    • You must notify us within 3 days of receiving the product.
    • You must provide clear photographic evidence of the damaged, broken, or faulty item.
    • The product must be unused and in its original packaging.

    3. How to Request a Replacement

    To request a replacement, please follow these steps:

    • Contact us at support@rppeptides@proton.me within 3 days of receiving your order.
    • Include your order number, a description of the issue, and clear photos of the damaged or faulty product.
    • Our team will review your request and respond as soon as possible with confirmation and next steps for your replacement.

    4. Shipping for Replacements

    We will cover the shipping costs for the replacement product if your claim is approved.

    5. Contact Us

    If you have any questions or concerns about your order or our replacement policy, please contact us:

    • Email: support@rppeptides@proton.me
    • WhatsApp: +44 7443 894309
  •  All prices are exempt of VAT, 20% will be applied at the checkout for VAT purposes.

Related Products

Top Quality UK Peptides

Contact

Tel: 07443894309
luxesolutions@proton.me

Follow Us

  • Instagram
Top Quality UK Peptides

Disclaimer for UK Peptides Purchases:

Disclaimer for RP Peptides Purchases:

By purchasing from us, you acknowledge and agree to the following terms:

Research Use Only: All products are exclusively sold for research purposes. They are not intended for human use, therapeutic, diagnostic, or clinical application.

Not Medical Products: None of the products listed on our website are medical products, nor should they be marketed or used as such.

Compliance and Responsibility: The buyer is responsible for ensuring compliance with all relevant laws and regulations. RP Peptides holds no liability for misuse of products or any adverse outcomes.

No Returns: Due to the nature of the products we sell, we do not accept returned products.

Your purchase signifies your understanding and agreement to these terms.

© 2024 RP Peptides. All rights reserved.

bottom of page